Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFA2, Human (HEK293, His)

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, His) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BPIFA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bpifa2-protein-human-hek293-his.html

Purity

90.00

Smiles

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Molecular Formula

140683 (Gene_ID) Q96DR5 (E19-I249) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tobramycin sulfate 500mg
A17956-500 500 mg

Tobramycin sulfate 500mg

Sign In for Pricing
View Details
KIF19 Overexpression Lysate (Native) - (Dry Ice)
NBP2-05273 0.1 mg

KIF19 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Mouse Monoclonal Anthrax LF Antibody (5F502.2) [Alexa Fluor 750]
NB100-56592AF750 0.1 mL

Mouse Monoclonal Anthrax LF Antibody (5F502.2) [Alexa Fluor 750]

Sign In for Pricing
View Details
Recombinant Human P2Y6/P2RY6 Protein - (Dry Ice)
H00005031-Q01-10ug 10 µg

Recombinant Human P2Y6/P2RY6 Protein - (Dry Ice)

Sign In for Pricing
View Details
PTPRJ siRNA (Mouse)
MBS8221459-01 15 nmol

PTPRJ siRNA (Mouse)

Sign In for Pricing
View Details
PTPRJ siRNA (Mouse)
MBS8221459-02 30 nmol

PTPRJ siRNA (Mouse)

Sign In for Pricing
View Details