Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFA2, Human (HEK293, His)

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, His) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BPIFA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bpifa2-protein-human-hek293-his.html

Purity

90.00

Smiles

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Molecular Formula

140683 (Gene_ID) Q96DR5 (E19-I249) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNH2 Human Pre-designed siRNA Set A
HY-RS07126 1 Set

KCNH2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Bak Rabbit Monoclonal Antibody
M01163-2-100μl 100 µL

Anti-Bak Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
COG5 (NM_001161520) Human Tagged Lenti ORF Clone
RC229021L3 10 µg

COG5 (NM_001161520) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse S100A11 ELISA Kit
EF013869 96 Tests

Mouse S100A11 ELISA Kit

Sign In for Pricing
View Details
Human SUSD2 Alexa Fluor 594 Antibody (Clone 1279A)
FAB90562T-100UG 100 µg

Human SUSD2 Alexa Fluor 594 Antibody (Clone 1279A)

Sign In for Pricing
View Details
Research Grade Rilvegostomig
DHH72420 100 μg

Research Grade Rilvegostomig

Sign In for Pricing
View Details