Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFA2, Human (HEK293, His)

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, His) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BPIFA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bpifa2-protein-human-hek293-his.html

Purity

90.00

Smiles

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Molecular Formula

140683 (Gene_ID) Q96DR5 (E19-I249) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTK Knockout CaSki Polyclonal Cells
ARG35443 1 Million

BTK Knockout CaSki Polyclonal Cells

Sign In for Pricing
View Details
Rat Monoclonal Caspase-11 Antibody (4E11) [Biotin]
NBP2-80100B 0.1 mL

Rat Monoclonal Caspase-11 Antibody (4E11) [Biotin]

Sign In for Pricing
View Details
Synaptonemal complex protein 2 (SYCP2) Rat ELISA Kit
H3953 96 Tests

Synaptonemal complex protein 2 (SYCP2) Rat ELISA Kit

Sign In for Pricing
View Details
SIGLEC15 Adenovirus (Rat)
43757056 1.0 mL

SIGLEC15 Adenovirus (Rat)

Sign In for Pricing
View Details
Lmf2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6482006 1.0 µg DNA

Lmf2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
SKIL (Ski-like Protein, Ski-related Oncogene, Ski-related Protein, SNO) (MaxLight 650)
133379-ML650 100 µL

SKIL (Ski-like Protein, Ski-related Oncogene, Ski-related Protein, SNO) (MaxLight 650)

Sign In for Pricing
View Details