Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Panax ginseng ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q68S19

Expression Region

1-81

Origin

Panax ginseng (Korean ginseng)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEDS1 (NM_199129) Human Recombinant Protein
TP324011 20 µg

PEDS1 (NM_199129) Human Recombinant Protein

Sign In for Pricing
View Details
Glucocorticoid Receptor (NR3C1) Human Gene Knockout Kit (CRISPR)
KN204878 1 Kit

Glucocorticoid Receptor (NR3C1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CC2D1A Rabbit Polyclonal Antibody
TA372184 100 µL

CC2D1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-(4-Hydroxybenzyl)-N,5-bis-(4-fluorophenyl)-5-hydroxypentanamide
TRC-H809740-10MG 10 mg

2-(4-Hydroxybenzyl)-N,5-bis-(4-fluorophenyl)-5-hydroxypentanamide

Sign In for Pricing
View Details
MOBKL2B (MOB3B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A3]
TA501579AM 100 µL

MOBKL2B (MOB3B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A3]

Sign In for Pricing
View Details
Glycitin 6''-O-Malonate
TRC-G635425-100MG 100 mg

Glycitin 6''-O-Malonate

Sign In for Pricing
View Details