Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nymphaea alba ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Nymphaea alba ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6EW61

Expression Region

1-81

Origin

Nymphaea alba (White water-lily) (Castalia alba)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-D-Glu(OBzl)-OBzl · p-tosylate
F-1570.0250 250.0g

H-D-Glu(OBzl)-OBzl · p-tosylate

Sign In for Pricing
View Details
Bovine keyhole limpet hemocyanin antibody (IgM) ELISA kit
GTR10467231 96 Well

Bovine keyhole limpet hemocyanin antibody (IgM) ELISA kit

Sign In for Pricing
View Details
GLG1 (NM_001145666) Human Tagged ORF Clone Lentiviral Particle
RC227054L3V 200 µL

GLG1 (NM_001145666) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Bop1 (NM_013481) Mouse Tagged ORF Clone
MG210344 10 µg

Bop1 (NM_013481) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ADD2 Antibody
A46038-50UL 50 μL

ADD2 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal NECAP2 Antibody
NBP2-97285-50ul 50 µL

Rabbit Polyclonal NECAP2 Antibody

Sign In for Pricing
View Details