Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter sp. ATP synthase subunit c (atpE)

This Recombinant Acinetobacter sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6FFK5

Expression Region

1-81

Origin

Acinetobacter sp. (strain ADP1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRP54 Recombinant Antibody, RBITC Conjugated
bsm-61994R-RBITC 100 µL

SRP54 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Mouse Numa1 Pre-designed siRNA Set B
SI109701B 1 Each

Mouse Numa1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
TMEM93 Overexpression Lysate (Native) - (Dry Ice)
NBL1-17111 0.1 mg

TMEM93 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
PSB9 / LMP2 Rabbit mAb Antibody
orb1950781-01 50 µL

PSB9 / LMP2 Rabbit mAb Antibody

Sign In for Pricing
View Details
PSB9 / LMP2 Rabbit mAb Antibody
orb1950781-02 100 µL

PSB9 / LMP2 Rabbit mAb Antibody

Sign In for Pricing
View Details
Sell Mouse siRNA Oligo Duplex (Locus ID 20343)
SR412549 1 Kit

Sell Mouse siRNA Oligo Duplex (Locus ID 20343)

Sign In for Pricing
View Details