Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Physcomitrella patens subsp. patens ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Physcomitrella patens subsp. patens ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6YXK1

Expression Region

1-81

Origin

Physcomitrella patens subsp. patens (Moss)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNJ5 Antibody
8G265-AAT 50 µg

KCNJ5 Antibody

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), 0.2mg/mL
BNUB1805-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), 0.2mg/mL

Sign In for Pricing
View Details
hHR23A (RAD23A) Human Gene Knockout Kit (CRISPR)
KN422684 1 Kit

hHR23A (RAD23A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100B (4C4.9), 1mg/mL
BNUM0143-50 1x 50 µL

S100B (4C4.9), 1mg/mL

Sign In for Pricing
View Details
RPL35 Antibody
8C14173-AAT 50 µg

RPL35 Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human/Mouse KLRG-1 Antibody[2F1]
E-AB-F1273UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Human/Mouse KLRG-1 Antibody[2F1]

Sign In for Pricing
View Details