Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cucumis sativus ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Cucumis sativus ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6WQW2

Expression Region

1-81

Origin

Cucumis sativus (Cucumber)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CHFR (NM_018223) AAV Particle
RC215377A1V 250 µL

Human CHFR (NM_018223) AAV Particle

Sign In for Pricing
View Details
Decorin (DCN) Canine ELISA Kit
C8340 96 Tests

Decorin (DCN) Canine ELISA Kit

Sign In for Pricing
View Details
ETF1P2 Protein Vector (Human) (pPB-N-His)
PV076234 500 ng

ETF1P2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
VAV3 siRNA (Mouse)
CRM5976-01 15 nmol

VAV3 siRNA (Mouse)

Sign In for Pricing
View Details
VAV3 siRNA (Mouse)
CRM5976-02 30 nmol

VAV3 siRNA (Mouse)

Sign In for Pricing
View Details
Recombinant HAdV-8 PII Protein (aa 1-517)
VAng-Cr4405-inquire Inquire

Recombinant HAdV-8 PII Protein (aa 1-517)

Sign In for Pricing
View Details