Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cucumis sativus ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Cucumis sativus ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6WQW2

Expression Region

1-81

Origin

Cucumis sativus (Cucumber)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF22 (INTS12) Human Over-expression Lysate
orb1370306 20 µg

PHF22 (INTS12) Human Over-expression Lysate

Sign In for Pricing
View Details
A830010M20Rik CRISPR Activation Plasmid (m)
sc-433076-ACT 20 µg

A830010M20Rik CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Olfr150 HDR Plasmid (m)
sc-434731-HDR 20 µg

Olfr150 HDR Plasmid (m)

Sign In for Pricing
View Details
TRIM29 Lentiviral Activation Particles (m2)
sc-428263-LAC-2 200 µL

TRIM29 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Mrpl38 ORF Vector (Rat) (pORF)
ORF070785 1.0 µg DNA

Mrpl38 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
HIC2 Antibody
GWB-685060 0.05 mg

HIC2 Antibody

Sign In for Pricing
View Details