Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q70Y12

Expression Region

1-81

Origin

Amborella trichopoda

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iodosulfuron
TRC-I736000-250MG 250 mg

Iodosulfuron

Sign In for Pricing
View Details
TMED1 (NM_006858) Human Over-expression Lysate
LC402049 20 µg

TMED1 (NM_006858) Human Over-expression Lysate

Sign In for Pricing
View Details
Olutasidenib
TRC-O299810-100MG 100 mg

Olutasidenib

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF640R conjugate, 0.1mg/mL
BNC402309-500 1x 500 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hexanoyl-L-carnitine Chloride
TRC-H294440-1G 1 g

Hexanoyl-L-carnitine Chloride

Sign In for Pricing
View Details
APC Anti-Mouse CD105 Antibody[MJ7/18]
E-AB-F1233E-01 50 Tests

APC Anti-Mouse CD105 Antibody[MJ7/18]

Sign In for Pricing
View Details