Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q70Y12

Expression Region

1-81

Origin

Amborella trichopoda

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Replication Protein A2 (RPA2) (RPA2/3140R), CF594 conjugate, 0.1mg/mL
BNC943140-100 1x 100 µL

Replication Protein A2 (RPA2) (RPA2/3140R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAIAP2 (NM_017450) Human Recombinant Protein
TP710123 20 µg

BAIAP2 (NM_017450) Human Recombinant Protein

Sign In for Pricing
View Details
Terlipressin-Phe(d5) Diacetate Salt
TRC-T115802-25MG 25 mg

Terlipressin-Phe(d5) Diacetate Salt

Sign In for Pricing
View Details
TRAF3IP2 Antibody
KC-37017-01 50 μL

TRAF3IP2 Antibody

Sign In for Pricing
View Details
TRAF3IP2 Antibody
KC-37017-02 100 µL

TRAF3IP2 Antibody

Sign In for Pricing
View Details
TRAF3IP2 Antibody
KC-37017-03 1 mL

TRAF3IP2 Antibody

Sign In for Pricing
View Details