Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psilotum nudum ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Psilotum nudum ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q7HJJ2

Expression Region

1-81

Origin

Psilotum nudum (Whisk fern) (Lycopodium nudum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Azido-peg8-nhs Ester (~90%)
TRC-A965580-50MG 50 mg

Azido-peg8-nhs Ester (~90%)

Sign In for Pricing
View Details
IGF2BP2 (NM_001007225) Human Over-expression Lysate
LY423450 100 µg

IGF2BP2 (NM_001007225) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZNF879 activation kit by CRISPRa
GA117611 1 Kit

Human ZNF879 activation kit by CRISPRa

Sign In for Pricing
View Details
Afatinib
TRC-A355300-250MG 250 mg

Afatinib

Sign In for Pricing
View Details
2-(2-Butoxyethoxy)acetic Acid
TRC-B415743-500MG 500 mg

2-(2-Butoxyethoxy)acetic Acid

Sign In for Pricing
View Details
ATG4B (NM_178326) Human Over-expression Lysate
LC403600 20 µg

ATG4B (NM_178326) Human Over-expression Lysate

Sign In for Pricing
View Details