Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psilotum nudum ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Psilotum nudum ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q7HJJ2

Expression Region

1-81

Origin

Psilotum nudum (Whisk fern) (Lycopodium nudum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSF Antibody
8C14568-AAT 50 µg

ARSF Antibody

Sign In for Pricing
View Details
IL5 Rabbit Polyclonal Antibody
AP20595PU-N 100 µg

IL5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Human SLC25A19 activation kit by CRISPRa
GA111844 1 Kit

Human SLC25A19 activation kit by CRISPRa

Sign In for Pricing
View Details
SERINC3 (NM_006811) Human Over-expression Lysate
LC402036 20 µg

SERINC3 (NM_006811) Human Over-expression Lysate

Sign In for Pricing
View Details