Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanidioschyzon merolae Cytochrome b559 subunit alpha (psbE)

This Recombinant Cyanidioschyzon merolae Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q85FQ2

Expression Region

1-81

Origin

Cyanidioschyzon merolae (Red alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGGSTGERPFSDIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFTQE RTQIPLVNDRFNAKQELEDLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-500 1x 500 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-500 1x 500 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL
BNC880676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-500 1x 500 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-500 1x 500 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details