Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q8RSW3

Expression Region

1-81

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGSTGERPFSDIVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDTFGTPRPDQYFTETR QEIPIVTDRYKAIDQINEFNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NP-I / NPTX1 Recombinant Rabbit monoclonal Antibody
HA751613 100 µL

NP-I / NPTX1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Meclofenamic Acid
TRC-M202750-25MG 25 mg

Meclofenamic Acid

Sign In for Pricing
View Details
Calnexin (CANX) (NM_001024649) Human Over-expression Lysate
LC422525 20 µg

Calnexin (CANX) (NM_001024649) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc16a11 Mouse Gene Knockout Kit (CRISPR)
KN515884 1 Kit

Slc16a11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse IGFBP-2, Tag Free
HA211197-01 20 µg

Mouse IGFBP-2, Tag Free

Sign In for Pricing
View Details
Mouse IGFBP-2, Tag Free
HA211197-02 50 µg

Mouse IGFBP-2, Tag Free

Sign In for Pricing
View Details