Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q8RSW3

Expression Region

1-81

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGSTGERPFSDIVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDTFGTPRPDQYFTETR QEIPIVTDRYKAIDQINEFNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEBPE Rabbit Polyclonal Antibody
TA364438 100 µL

CEBPE Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GTSF1 Rabbit Polyclonal Antibody
ER1803-68 100 µL

GTSF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Troponin C1 (TNNC1) (NM_003280) Human Recombinant Protein
TP307014 20 µg

Troponin C1 (TNNC1) (NM_003280) Human Recombinant Protein

Sign In for Pricing
View Details
IL28 Receptor alpha (IFNLR1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B2]
TA812616AM 100 µL

IL28 Receptor alpha (IFNLR1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B2]

Sign In for Pricing
View Details
Bmp1 Mouse Gene Knockout Kit (CRISPR)
KN502191 1 Kit

Bmp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse CCL3 Recombinant Rabbit Monoclonal Antibody [PSH08-40] - BSA and Azide free (Detector)
HA722983 100 µL

Mouse CCL3 Recombinant Rabbit Monoclonal Antibody [PSH08-40] - BSA and Azide free (Detector)

Sign In for Pricing
View Details