Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q8RSW3

Expression Region

1-81

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGSTGERPFSDIVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDTFGTPRPDQYFTETR QEIPIVTDRYKAIDQINEFNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc N-Hydroxysuccinimide Ester
TRC-F634000-250G 250 g

Fmoc N-Hydroxysuccinimide Ester

Sign In for Pricing
View Details
CA7 (NM_001014435) Human Over-expression Lysate
LC423060 20 µg

CA7 (NM_001014435) Human Over-expression Lysate

Sign In for Pricing
View Details
Fluo -4 AM - Green fluorescent calcium indicator
1041F 10x 50 µg

Fluo -4 AM - Green fluorescent calcium indicator

Sign In for Pricing
View Details
HDHD3 Mouse Monoclonal Antibody [Clone ID: OTI1C5]
CF811491 100 µg

HDHD3 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

Sign In for Pricing
View Details
Dihydroabietyl Alcohol
TRC-D446950-5MG 5 mg

Dihydroabietyl Alcohol

Sign In for Pricing
View Details
Alpha-Casein (90-96) Trifluoroacetate Salt
TRC-A279400-5MG 5 mg

Alpha-Casein (90-96) Trifluoroacetate Salt

Sign In for Pricing
View Details