Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q8MA07

Expression Region

1-81

Origin

Chaetosphaeridium globosum

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIASASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEVDGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Mouse IL-9 Recombinant Rabbit Monoclonal Antibody [PS01-82] - BSA and Azide free (Detector)
HA721605 100 µL

Biotin Conjugated Mouse IL-9 Recombinant Rabbit Monoclonal Antibody [PS01-82] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
5-Desthiopropyl-5-hydroxy-ticagrelor
TRC-D297505-1MG 1 mg

5-Desthiopropyl-5-hydroxy-ticagrelor

Sign In for Pricing
View Details
Human IL-8/CXCL8 Tag Free
HA210642-01 20 µg

Human IL-8/CXCL8 Tag Free

Sign In for Pricing
View Details
Human IL-8/CXCL8 Tag Free
HA210642-02 50 µg

Human IL-8/CXCL8 Tag Free

Sign In for Pricing
View Details
Human IL-8/CXCL8 Tag Free
HA210642-03 100 µg

Human IL-8/CXCL8 Tag Free

Sign In for Pricing
View Details
Human Syntrophin alpha 1 (SNTA1) activation kit by CRISPRa
GA104551 1 Kit

Human Syntrophin alpha 1 (SNTA1) activation kit by CRISPRa

Sign In for Pricing
View Details