Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Atropa belladonna ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Atropa belladonna ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q8RU61

Expression Region

1-81

Origin

Atropa belladonna (Belladonna) (Deadly nightshade)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLVFAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]
E-AB-F1242S-01 20 Tests

Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]
E-AB-F1242S-02 100 Tests

Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]
E-AB-F1242S-03 2x 100 Tests

Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
OR4N5 (NM_001004724) Human Over-expression Lysate
LC423907 20 µg

OR4N5 (NM_001004724) Human Over-expression Lysate

Sign In for Pricing
View Details
FAHD2A (NM_016044) Human Over-expression Lysate
LC402492 20 µg

FAHD2A (NM_016044) Human Over-expression Lysate

Sign In for Pricing
View Details
P27 KIP 1 Recombinant Rabbit monoclonal Antibody
HA750157 100 µL

P27 KIP 1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details