Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Atropa belladonna ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Atropa belladonna ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q8RU61

Expression Region

1-81

Origin

Atropa belladonna (Belladonna) (Deadly nightshade)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLVFAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FastClick™ Cy3 Alkyne
72850-AAT 1 mg

FastClick™ Cy3 Alkyne

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-500 1x 500 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Quinfamide
TRC-Q670600-50MG 50 mg

Quinfamide

Sign In for Pricing
View Details
PARP1 (NM_001618) Human Recombinant Protein
TP710053 20 µg

PARP1 (NM_001618) Human Recombinant Protein

Sign In for Pricing
View Details
MAGEA3 Antibody
OC-059-01 50 μL

MAGEA3 Antibody

Sign In for Pricing
View Details
MAGEA3 Antibody
OC-059-02 100 µL

MAGEA3 Antibody

Sign In for Pricing
View Details