Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Atropa belladonna ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Atropa belladonna ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q8RU61

Expression Region

1-81

Origin

Atropa belladonna (Belladonna) (Deadly nightshade)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLVFAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDI1 Polyclonal Antibody
E-AB-90689-01 60 µL

IDI1 Polyclonal Antibody

Sign In for Pricing
View Details
IDI1 Polyclonal Antibody
E-AB-90689-02 120 µL

IDI1 Polyclonal Antibody

Sign In for Pricing
View Details
IDI1 Polyclonal Antibody
E-AB-90689-03 200 µL

IDI1 Polyclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF740 conjugate, 0.1mg/mL
BNC740597-100 1x 100 µL

Alkaline Phosphatase (ALPL/597), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biotin Conjugated Human CCL25 Recombinant Rabbit Monoclonal Antibody [PSH08-67] - Detector
HA723019B 100 µL

Biotin Conjugated Human CCL25 Recombinant Rabbit Monoclonal Antibody [PSH08-67] - Detector

Sign In for Pricing
View Details
Mouse CXCL16 Recombinant Rabbit monoclonal Antibody
HA723943B 100 µL

Mouse CXCL16 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details