Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse V-type proton ATPase subunit e 2 (Atp6v0e2)

This Recombinant Mouse V-type proton ATPase subunit e 2 (Atp6v0e2) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

V-type proton ATPase subunit e 2, V-ATPase subunit e 2, Vacuolar proton pump subunit e 2

UniProt

Q91XE7

Expression Region

1-81

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD8 Antibody[UCHT-4]
AN00427D-01 20 Tests

PE Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
PE Anti-Human CD8 Antibody[UCHT-4]
AN00427D-02 100 Tests

PE Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
PE Anti-Human CD8 Antibody[UCHT-4]
AN00427D-03 2x 100 Tests

PE Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
SIRT5 (NM_001193267) Human Over-expression Lysate
LY434135 100 µg

SIRT5 (NM_001193267) Human Over-expression Lysate

Sign In for Pricing
View Details
CPA1 Rabbit Polyclonal Antibody
TA396946S 25 µL

CPA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
alpha 1 Catenin (CTNNA1) Rabbit Monoclonal Antibody
TA422600 100 µL

alpha 1 Catenin (CTNNA1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details