Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse V-type proton ATPase subunit e 2 (Atp6v0e2)

This Recombinant Mouse V-type proton ATPase subunit e 2 (Atp6v0e2) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

V-type proton ATPase subunit e 2, V-ATPase subunit e 2, Vacuolar proton pump subunit e 2

UniProt

Q91XE7

Expression Region

1-81

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAS1R2 Human Gene Knockout Kit (CRISPR)
KN418543 1 Kit

TAS1R2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(1-Hydroxycyclohexyl)acetic Acid
TRC-H954453-10MG 10 mg

(1-Hydroxycyclohexyl)acetic Acid

Sign In for Pricing
View Details
NucSpot® Live 488 Nuclear Stain, Trial Size
#40081-T 1 Kit

NucSpot® Live 488 Nuclear Stain, Trial Size

Sign In for Pricing
View Details
2’-Deoxy-Beta-L-adenosine
TRC-D231625-25MG 25 mg

2’-Deoxy-Beta-L-adenosine

Sign In for Pricing
View Details
TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/2770), CF640R conjugate, 0.1mg/mL
BNC402770-100 1x 100 µL

TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/2770), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), 0.2mg/mL
BNUB1577-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), 0.2mg/mL

Sign In for Pricing
View Details