Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse V-type proton ATPase subunit e 2 (Atp6v0e2)

This Recombinant Mouse V-type proton ATPase subunit e 2 (Atp6v0e2) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

V-type proton ATPase subunit e 2, V-ATPase subunit e 2, Vacuolar proton pump subunit e 2

UniProt

Q91XE7

Expression Region

1-81

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ola1 activation kit by CRISPRa
GA207114 1 Kit

Mouse Ola1 activation kit by CRISPRa

Sign In for Pricing
View Details
Disperse Blue 60 (Technical Grade)
TRC-D493558-500MG 500 mg

Disperse Blue 60 (Technical Grade)

Sign In for Pricing
View Details
Slc11a2 Mouse Gene Knockout Kit (CRISPR)
KN315860BN 1 Kit

Slc11a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF690 / ZSCAN29 (ZSCAN29/2610), CF405S conjugate, 0.1mg/mL
BNC042610-100 1x 100 µL

ZNF690 / ZSCAN29 (ZSCAN29/2610), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ubiquitin Rabbit Polyclonal Antibody
ER31212 100 µL

Ubiquitin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2788), CF640R conjugate, 0.1mg/mL
BNC402788-500 1x 500 µL

CD63 (Late Endosomes Marker) (LAMP3/2788), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details