Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cortexin-2 (CTXN2)

This Recombinant Human Cortexin-2 (CTXN2) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cortexin-2

UniProt

P0C2S0

Expression Region

1-81

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTYCGNSSAKMSVNEVSAFSLTLEQKTGFAFVGILCIFLGLLIIRCFKILLDPYSSMP SSTWEDEVEEFDKGTFEYALA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Uba7 shRNA (UAS) - Lentiviral mouse Uba7 shRNA (UAS) (25)
GTR15274457 1 Vial

Lentiviral mouse Uba7 shRNA (UAS) - Lentiviral mouse Uba7 shRNA (UAS) (25)

Sign In for Pricing
View Details
CTDSP1 Rabbit Polyclonal Antibody
orb331304 100 µL

CTDSP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat WNT1 Inducible Signaling Pathway Protein 1 (WISP1) ELISA Kit
RDR-WISP1-Ra-01 48 Tests

Rat WNT1 Inducible Signaling Pathway Protein 1 (WISP1) ELISA Kit

Sign In for Pricing
View Details
Rat WNT1 Inducible Signaling Pathway Protein 1 (WISP1) ELISA Kit
RDR-WISP1-Ra-02 96 Tests

Rat WNT1 Inducible Signaling Pathway Protein 1 (WISP1) ELISA Kit

Sign In for Pricing
View Details
TSNAX, NT (TSNAX, TRAX, Translin-associated protein X, Translin-associated factor X) (PE) discontinued
043371-PE 200 µL

TSNAX, NT (TSNAX, TRAX, Translin-associated protein X, Translin-associated factor X) (PE) discontinued

Sign In for Pricing
View Details
TUBd (Tubulin Delta, TUBD1)
365478 200 µL

TUBd (Tubulin Delta, TUBD1)

Sign In for Pricing
View Details