Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cortexin-2 (CTXN2)

This Recombinant Human Cortexin-2 (CTXN2) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cortexin-2

UniProt

P0C2S0

Expression Region

1-81

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTYCGNSSAKMSVNEVSAFSLTLEQKTGFAFVGILCIFLGLLIIRCFKILLDPYSSMP SSTWEDEVEEFDKGTFEYALA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rotavirus VP6 (Rotavirus VP-6, Rotavirus VP-6, VP6) (HRP)
MBS6262631-01 0.1 mL

Rotavirus VP6 (Rotavirus VP-6, Rotavirus VP-6, VP6) (HRP)

Sign In for Pricing
View Details
Rotavirus VP6 (Rotavirus VP-6, Rotavirus VP-6, VP6) (HRP)
MBS6262631-02 5x 0.1 mL

Rotavirus VP6 (Rotavirus VP-6, Rotavirus VP-6, VP6) (HRP)

Sign In for Pricing
View Details
ASB13 Human
OM303532-01 5 µg

ASB13 Human

Sign In for Pricing
View Details
ASB13 Human
OM303532-02 20 µg

ASB13 Human

Sign In for Pricing
View Details
ASB13 Human
OM303532-03 1 mg

ASB13 Human

Sign In for Pricing
View Details
FAM167A 3'UTR GFP Stable Cell Line
TU057615 1.0 mL

FAM167A 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details