Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Triticum aestivum ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Triticum aestivum ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P69448

Expression Region

1-81

Origin

Triticum aestivum (Wheat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT23 (NM_015515) Human Over-expression Lysate
LC402445 20 µg

KRT23 (NM_015515) Human Over-expression Lysate

Sign In for Pricing
View Details
Semaphorin 3D (SEMA3D) Mouse Monoclonal Antibody [Clone ID: OTI2H4]
CF809917 100 µg

Semaphorin 3D (SEMA3D) Mouse Monoclonal Antibody [Clone ID: OTI2H4]

Sign In for Pricing
View Details
IL33 (NM_033439) Human Recombinant Protein
TP720207L 500 µg

IL33 (NM_033439) Human Recombinant Protein

Sign In for Pricing
View Details
Triple Dye Loading Buffer (6X)
EC-855 1.2 mL

Triple Dye Loading Buffer (6X)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS647372 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Thyroglobulin (TG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8E1]
TA804213BM 100 µL

Thyroglobulin (TG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8E1]

Sign In for Pricing
View Details