Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P69194

Expression Region

1-81

Origin

Lotus japonicus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB13 Antibody
orb1322655 100 µL

SERPINB13 Antibody

Sign In for Pricing
View Details
XCR1 Protein Vector (Rat) (pPM-C-His)
PV316789 500 ng

XCR1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
NAT14 Antibody (N-term) [APR30578G]
APR30578G-01 50 µL

NAT14 Antibody (N-term) [APR30578G]

Sign In for Pricing
View Details
NAT14 Antibody (N-term) [APR30578G]
APR30578G-02 100 µL

NAT14 Antibody (N-term) [APR30578G]

Sign In for Pricing
View Details
NAT14 Antibody (N-term) [APR30578G]
APR30578G-03 200 µL

NAT14 Antibody (N-term) [APR30578G]

Sign In for Pricing
View Details
NAT14 Antibody (N-term) [APR30578G]
APR30578G-04 400 µL

NAT14 Antibody (N-term) [APR30578G]

Sign In for Pricing
View Details