Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P69194

Expression Region

1-81

Origin

Lotus japonicus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCR4-TOPO-CNTNAP2 Plasmid
PVT15979 2 µg

pCR4-TOPO-CNTNAP2 Plasmid

Sign In for Pricing
View Details
Recombinant Dog IL6/Interleukin-6 Protein, C-Fc
AP97116 50 µg

Recombinant Dog IL6/Interleukin-6 Protein, C-Fc

Sign In for Pricing
View Details
RPL6 Antibody
E313471 200 µL

RPL6 Antibody

Sign In for Pricing
View Details
Mouse Kallikrein 1-related peptidase b9, Klk1b9 ELISA KIT
ELI-39202m 96 Tests

Mouse Kallikrein 1-related peptidase b9, Klk1b9 ELISA KIT

Sign In for Pricing
View Details
Anti-Oct-2 Rabbit Monoclonal Antibody
M04407-3-200μl 200 µL

Anti-Oct-2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Stanniocalcin 1 (STC1) Mouse ELISA Kit
H3074 96 Tests

Stanniocalcin 1 (STC1) Mouse ELISA Kit

Sign In for Pricing
View Details