Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P69194

Expression Region

1-81

Origin

Lotus japonicus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB3 Polyclonal Antibody
ANT-14343-50ug 50 µg

SERPINB3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Cyclophilin B (6H1) Mouse Monoclonal Antibody
MA2127-.05 50 µL

Anti-Cyclophilin B (6H1) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Bovine Glutaredoxin-3 ELISA Kit
OM617144 96 Strip Well

Bovine Glutaredoxin-3 ELISA Kit

Sign In for Pricing
View Details
Porcine Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) ELISA Kit
MBS7238696-01 48 Well

Porcine Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) ELISA Kit

Sign In for Pricing
View Details
Porcine Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) ELISA Kit
MBS7238696-02 96 Well

Porcine Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) ELISA Kit

Sign In for Pricing
View Details
Porcine Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) ELISA Kit
MBS7238696-03 5x 96 Well

Porcine Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) ELISA Kit

Sign In for Pricing
View Details