Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Zea mays ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P69449

Expression Region

1-81

Origin

Zea mays (Maize)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFkB/NFKB2 p100/p52 Rabbit Polyclonal Antibody (Fluoro594)
orb3078682 100 µg

NFkB/NFKB2 p100/p52 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Nox4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3877003 1.0 µg DNA

Nox4 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TMEM8A Protein Vector (Rat) (pPB-N-His)
PV311855 500 ng

TMEM8A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Monoclonal Ghrelin Receptor/GHSR Antibody (502430) [DyLight 488]
FAB8370K 0.1 mL

Mouse Monoclonal Ghrelin Receptor/GHSR Antibody (502430) [DyLight 488]

Sign In for Pricing
View Details
Lentiviral human TIPRL shRNA (UAS) - Lentiviral human TIPRL shRNA (UAS, iRFP) (100)
GTR15341610 1 Vial

Lentiviral human TIPRL shRNA (UAS) - Lentiviral human TIPRL shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
FUK Polyclonal Antibody
MBS8571894-01 0.1 mL

FUK Polyclonal Antibody

Sign In for Pricing
View Details