Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Oryza sativa ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P0C2Z9

Expression Region

1-81

Origin

Oryza sativa (Rice)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKIB1 siRNA
abx907503-01 15 nmol

Human ANKIB1 siRNA

Sign In for Pricing
View Details
Human ANKIB1 siRNA
abx907503-02 30 nmol

Human ANKIB1 siRNA

Sign In for Pricing
View Details
TNFSF11 Rabbit Polyclonal Antibody (Cy3)
orb3118770 100 µg

TNFSF11 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
SPATA7 (NM_018418) Human Over-expression Lysate
LS055812 100 µg

SPATA7 (NM_018418) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human ARP3 Actin-Related Protein 3
MBS556246-01 0.005 mg

Recombinant Human ARP3 Actin-Related Protein 3

Sign In for Pricing
View Details
Recombinant Human ARP3 Actin-Related Protein 3
MBS556246-02 0.02 mg

Recombinant Human ARP3 Actin-Related Protein 3

Sign In for Pricing
View Details