Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Oryza sativa ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P0C2Z9

Expression Region

1-81

Origin

Oryza sativa (Rice)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cluster of Differentiation 83 (CD83) ELISA Kit-Sandwich
EK5F646-01 48 Test

Mouse Cluster of Differentiation 83 (CD83) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Cluster of Differentiation 83 (CD83) ELISA Kit-Sandwich
EK5F646-02 96 Tests

Mouse Cluster of Differentiation 83 (CD83) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Agouti (1-40) amide (Human) - I-125 Labeled Purified IgG
T-G-003-50 10 µCi

Agouti (1-40) amide (Human) - I-125 Labeled Purified IgG

Sign In for Pricing
View Details
AKT1 Mouse Monoclonal Antibody [Clone ID: 18F3.H11]
TA319561 50 µg

AKT1 Mouse Monoclonal Antibody [Clone ID: 18F3.H11]

Sign In for Pricing
View Details
Mouse Ppp1r3b activation kit by CRISPRa
GA215195 1 Kit

Mouse Ppp1r3b activation kit by CRISPRa

Sign In for Pricing
View Details
L3MBTL3 Rabbit pAb
A7289-01 20 µL

L3MBTL3 Rabbit pAb

Sign In for Pricing
View Details