Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. ATP synthase subunit c (atpE)

This Recombinant Nostoc sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P12409

Expression Region

1-81

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLVSAASVLAAALAVGLAAIGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCDH-CMV-CD19-EF1a-Puro-WPRE Plasmid
PVT35941 2 µg

pCDH-CMV-CD19-EF1a-Puro-WPRE Plasmid

Sign In for Pricing
View Details
EP1 CRISPR Activation Plasmid (h2)
sc-402565-ACT-2 20 µg

EP1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Taf10 3'UTR Lenti-reporter-Luc Vector
46068084 1.0 µg

Taf10 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RSK1 monoclonal antibody
orb1677046-01 50 µL

RSK1 monoclonal antibody

Sign In for Pricing
View Details
RSK1 monoclonal antibody
orb1677046-02 100 µL

RSK1 monoclonal antibody

Sign In for Pricing
View Details
RSK1 monoclonal antibody
orb1677046-03 200 µL

RSK1 monoclonal antibody

Sign In for Pricing
View Details