Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. ATP synthase subunit c (atpE)

This Recombinant Nostoc sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P12409

Expression Region

1-81

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLVSAASVLAAALAVGLAAIGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMC3IP Rabbit Polyclonal Antibody (APC)
orb1001655 100 µL

PSMC3IP Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Goose Guanylate Cyclase Activator 2A ELISA Kit
MBS104782 Inquire

Goose Guanylate Cyclase Activator 2A ELISA Kit

Sign In for Pricing
View Details
ATP6V0C antibody - middle region (ARP45161_P050)
ARP45161_P050 100 µL

ATP6V0C antibody - middle region (ARP45161_P050)

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to TNFRSF11A
MBS8537247-01 0.1 mL

Mouse Monoclonal Antibody to TNFRSF11A

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to TNFRSF11A
MBS8537247-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to TNFRSF11A

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to TNFRSF11A
MBS8537247-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to TNFRSF11A

Sign In for Pricing
View Details