Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. ATP synthase subunit c (atpE)

This Recombinant Nostoc sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P12409

Expression Region

1-81

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLVSAASVLAAALAVGLAAIGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP7 Conjugated Antibody
C38522 100 µL

IGFBP7 Conjugated Antibody

Sign In for Pricing
View Details
Kallikrein 1 (KLK1) Polyclonal Antibody
CAU37304-01 100 µL

Kallikrein 1 (KLK1) Polyclonal Antibody

Sign In for Pricing
View Details
Kallikrein 1 (KLK1) Polyclonal Antibody
CAU37304-02 200 µL

Kallikrein 1 (KLK1) Polyclonal Antibody

Sign In for Pricing
View Details
Kallikrein 1 (KLK1) Polyclonal Antibody
CAU37304-03 1 mL

Kallikrein 1 (KLK1) Polyclonal Antibody

Sign In for Pricing
View Details
ADH1B Peptide
DF12809-BP 1 mg

ADH1B Peptide

Sign In for Pricing
View Details
ZNF237 (ZMYM5) (NM_001142684) Human Tagged ORF Clone Lentiviral Particle
RC227904L4V 200 µL

ZNF237 (ZMYM5) (NM_001142684) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details