Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yczI (yczI)

This Recombinant Bacillus subtilis Uncharacterized protein yczI (yczI) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Uncharacterized protein yczI

UniProt

P42970

Expression Region

1-81

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRIFKMSFAVIIIILALIAFNYTEHTSVIQSVMLVFLGAVMFMQGLEERKKENDGSGAF NIYTAVFVWSVSLIGFTLHII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bilastine Related Compound C
TRC-B164320-50MG 50 mg

Bilastine Related Compound C

Sign In for Pricing
View Details
Recombinant Mouse Annexin V protein (His tag)
PDEM100289-01 20 µg

Recombinant Mouse Annexin V protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Annexin V protein (His tag)
PDEM100289-02 100 µg

Recombinant Mouse Annexin V protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Annexin V protein (His tag)
PDEM100289-03 500 µg

Recombinant Mouse Annexin V protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Annexin V protein (His tag)
PDEM100289-04 1 mg

Recombinant Mouse Annexin V protein (His tag)

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (B2M/961), CF405S conjugate, 0.1mg/mL
BNC040961-500 1x 500 µL

Beta-2 Microglobulin (B2M) (B2M/961), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details