Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yczI (yczI)

This Recombinant Bacillus subtilis Uncharacterized protein yczI (yczI) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Uncharacterized protein yczI

UniProt

P42970

Expression Region

1-81

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRIFKMSFAVIIIILALIAFNYTEHTSVIQSVMLVFLGAVMFMQGLEERKKENDGSGAF NIYTAVFVWSVSLIGFTLHII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ssh1 Mouse Gene Knockout Kit (CRISPR)
KN516762 1 Kit

Ssh1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Bromoisobutyric Acid
TRC-B684645-25G 25 g

2-Bromoisobutyric Acid

Sign In for Pricing
View Details
ABCD1 (Center) Rabbit Polyclonal Antibody
AP50017PU-N 400 µL

ABCD1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (D33), CF594 conjugate, 0.1mg/mL
BNC941722-100 1x 100 µL

Desmin (Muscle Cell Marker) (D33), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WRN Human Gene Knockout Kit (CRISPR)
KN222919LP 1 Kit

WRN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDE9A (NM_001001577) Human Over-expression Lysate
LC424394 20 µg

PDE9A (NM_001001577) Human Over-expression Lysate

Sign In for Pricing
View Details