Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P51246

Expression Region

1-82

Origin

Porphyra purpurea

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSIVSAASVIAAGLAVGLAAIGPGIGQGSAAANAVEGIARQPEVEGKIRGTLLLSLAFM ESLTIYGLVVALSLLFANPYVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-[(4-Chloro-2-pyrimidinyl)amino]-benzonitrile
TRC-C379835-25MG 25 mg

4-[(4-Chloro-2-pyrimidinyl)amino]-benzonitrile

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF568 conjugate, 0.1mg/mL
BNC682312-100 1x 100 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RTL8A activation kit by CRISPRa
GA108736 1 Kit

Human RTL8A activation kit by CRISPRa

Sign In for Pricing
View Details
EverBrite TrueBlack® Hardset Mounting Medium
#23017 1x 10 mL

EverBrite TrueBlack® Hardset Mounting Medium

Sign In for Pricing
View Details
Slc35e4 Mouse Gene Knockout Kit (CRISPR)
KN516071 1 Kit

Slc35e4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Atp23 Mouse Gene Knockout Kit (CRISPR)
KN519526 1 Kit

Atp23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details