Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P51246

Expression Region

1-82

Origin

Porphyra purpurea

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSIVSAASVIAAGLAVGLAAIGPGIGQGSAAANAVEGIARQPEVEGKIRGTLLLSLAFM ESLTIYGLVVALSLLFANPYVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCL1 (T-Cell Marker) (TCL1/2078), CF568 conjugate, 0.1mg/mL
BNC682078-100 1x 100 µL

TCL1 (T-Cell Marker) (TCL1/2078), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2), Biotin conjugate, 0.1mg/mL
BNCB0523-100 1x 100 µL

AFP (Alpha Fetoprotein) (C2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Polystyrene Triphenylphosphine
HR40031-0.100G 100 g

Polystyrene Triphenylphosphine

Sign In for Pricing
View Details
Cytokeratin 7/17 (C-46), CF488A conjugate, 0.1mg/mL
BNC880949-100 1x 100 µL

Cytokeratin 7/17 (C-46), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD146 Antibody[P1H12]
AN00323L-01 20 Tests

Elab Fluor® 488 Anti-Human CD146 Antibody[P1H12]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD146 Antibody[P1H12]
AN00323L-02 100 Tests

Elab Fluor® 488 Anti-Human CD146 Antibody[P1H12]

Sign In for Pricing
View Details