Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorella vulgaris ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Chlorella vulgaris ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P56297

Expression Region

1-82

Origin

Chlorella vulgaris (Green alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIVAAASVIAAGLAVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFM ESLTIYGLVVALALLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6N2 (NM_001005278) Human Over-expression Lysate
LY423837 100 µg

OR6N2 (NM_001005278) Human Over-expression Lysate

Sign In for Pricing
View Details
CD8 (C8/144B), CF640R conjugate, 0.1mg/mL
BNC400749-100 1x 100 µL

CD8 (C8/144B), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tazobactam Sodium Salt-15N3
TRC-T010103-1MG 1 mg

Tazobactam Sodium Salt-15N3

Sign In for Pricing
View Details
UBE2I Human Gene Knockout Kit (CRISPR)
KN201199 1 Kit

UBE2I Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mucin-14 Antibody
8C11879-AAT 50 µg

Mucin-14 Antibody

Sign In for Pricing
View Details
CD3e (CRIS-7), 1mg/mL
BNUM1050-50 1x 50 µL

CD3e (CRIS-7), 1mg/mL

Sign In for Pricing
View Details