Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0410 protein yeaQ (yeaQ)

This Recombinant UPF0410 protein yeaQ (yeaQ) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

UPF0410 protein yeaQ

UniProt

P64487

Expression Region

1-82

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGILSWIIFGLIAGILAKWIMPGKDGGGFFMTILLGIVGAVVGGWISTLFGFGKVDGFNF GSFVVAVIGAIVVLFIYRKIKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Calcineurin (CaN) ELISA Kit
RD-CaN-Mu-01 96 Tests

Mouse Calcineurin (CaN) ELISA Kit

Sign In for Pricing
View Details
Mouse Calcineurin (CaN) ELISA Kit
RD-CaN-Mu-02 48 Tests

Mouse Calcineurin (CaN) ELISA Kit

Sign In for Pricing
View Details
Auxin response factor Mouse Monoclonal Antibody [14D2]
EM1901-06 100 µL

Auxin response factor Mouse Monoclonal Antibody [14D2]

Sign In for Pricing
View Details
1-Palmitoyl-2-oleoyl-sn-glycero-3-phospho-(1'-rac-glycerol) Sodium Salt
TRC-P160980-50MG 50 mg

1-Palmitoyl-2-oleoyl-sn-glycero-3-phospho-(1'-rac-glycerol) Sodium Salt

Sign In for Pricing
View Details
SHCBP1 Human Gene Knockout Kit (CRISPR)
KN205527 1 Kit

SHCBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]
AM09053PU-N 100 µL

WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]

Sign In for Pricing
View Details