Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0410 protein yeaQ (yeaQ)

This Recombinant UPF0410 protein yeaQ (yeaQ) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

UPF0410 protein yeaQ

UniProt

P64487

Expression Region

1-82

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGILSWIIFGLIAGILAKWIMPGKDGGGFFMTILLGIVGAVVGGWISTLFGFGKVDGFNF GSFVVAVIGAIVVLFIYRKIKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIM1 Human Gene Knockout Kit (CRISPR)
KN422805 1 Kit

SIM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TEPP
TRC-T100100-25MG 25 mg

TEPP

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2492), CF405S conjugate, 0.1mg/mL
BNC042492-500 1x 500 µL

ATG5 (Autophagy Marker) (ATG5/2492), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD42d (GP5) Human Gene Knockout Kit (CRISPR)
KN418870 1 Kit

CD42d (GP5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16, Biotin conjugate, 0.1mg/mL
BNCB1633-500 1x 500 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16, Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Multi-Well Plate
KF22US-9-N 50 Pack/Case

Multi-Well Plate

Sign In for Pricing
View Details