Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A2C6X1

Expression Region

1-82

Origin

Prochlorococcus marinus (strain MIT 9303)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITTAASVVAAGLAVGLGAIGPGIGQGTAAGGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Arginyl tRNA protein transferase 1 (ATE1) ELISA Kit
MBS7202513-01 48 Well

Human Arginyl tRNA protein transferase 1 (ATE1) ELISA Kit

Sign In for Pricing
View Details
Human Arginyl tRNA protein transferase 1 (ATE1) ELISA Kit
MBS7202513-02 96 Well

Human Arginyl tRNA protein transferase 1 (ATE1) ELISA Kit

Sign In for Pricing
View Details
Human Arginyl tRNA protein transferase 1 (ATE1) ELISA Kit
MBS7202513-03 5x 96 Well

Human Arginyl tRNA protein transferase 1 (ATE1) ELISA Kit

Sign In for Pricing
View Details
Human Arginyl tRNA protein transferase 1 (ATE1) ELISA Kit
MBS7202513-04 10x 96 Well

Human Arginyl tRNA protein transferase 1 (ATE1) ELISA Kit

Sign In for Pricing
View Details
TOMM5 3'UTR GFP Stable Cell Line
TU076091 1.0 mL

TOMM5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Chenodeoxycholic Acid
B1908-100 100 mg

Chenodeoxycholic Acid

Sign In for Pricing
View Details