Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)

This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A2CCQ0

Expression Region

1-82

Origin

Prochlorococcus marinus (strain MIT 9303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTGERPFFEIVTSIRYWVIHAVTLPSIFLAGYLFVSTGLAYDTFGTPRPDAYFQAS ESKAPVVSQRYEAKSQLDLRLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR182 (NM_007264) Human Tagged ORF Clone Lentiviral Particle
RC206505L4V 200 µL

GPR182 (NM_007264) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KREMEN1 (NM_001039571) Human Untagged Clone
SC322731 10 µg

KREMEN1 (NM_001039571) Human Untagged Clone

Sign In for Pricing
View Details
IL2RA/CD25 Mouse Monoclonal Antibody (APC)
orb1975502 100 µL

IL2RA/CD25 Mouse Monoclonal Antibody (APC)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Eukaryotic translation initiation factor 2A (eif2a), partial
MBS1463161 Inquire

Recombinant Dictyostelium discoideum Eukaryotic translation initiation factor 2A (eif2a), partial

Sign In for Pricing
View Details
FZD8 Conjugated Antibody
MBS9447740-01 0.1 mL (Biotin)

FZD8 Conjugated Antibody

Sign In for Pricing
View Details
FZD8 Conjugated Antibody
MBS9447740-02 0.1 mL (AF350)

FZD8 Conjugated Antibody

Sign In for Pricing
View Details