Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU4 Envelope small membrane protein (E)

This Recombinant Bat coronavirus HKU4 Envelope small membrane protein (E) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

A3EX99

Expression Region

1-82

Origin

Bat coronavirus HKU4 (BtCoV) (BtCoV/HKU4/2004)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFVHEQIGTIIVNFFILTVVCAITLVVCLAILTAIRLCVQCASGVNTLLFVPAFYIYN TGRNAYFKFQENRPPFPPEDWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 (CVID3/155), CF640R conjugate, 0.1mg/mL
BNC400155-500 1x 500 µL

CD19 (CVID3/155), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD134, Mouse (OX40) (OX-86), CF594 conjugate, 0.1mg/mL
BNC942004-500 1x 500 µL

CD134, Mouse (OX40) (OX-86), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ascorbate Oxidase Microplate Assay Kit
RDSM051 100 Assays

Ascorbate Oxidase Microplate Assay Kit

Sign In for Pricing
View Details
SARS2 Rabbit Polyclonal Antibody
ER1902-38 100 µL

SARS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF317 Mouse Monoclonal Antibody [Clone ID: OTI10C5]
CF812519 100 µg

ZNF317 Mouse Monoclonal Antibody [Clone ID: OTI10C5]

Sign In for Pricing
View Details