Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU4 Envelope small membrane protein (E)

This Recombinant Bat coronavirus HKU4 Envelope small membrane protein (E) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

A3EX99

Expression Region

1-82

Origin

Bat coronavirus HKU4 (BtCoV) (BtCoV/HKU4/2004)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFVHEQIGTIIVNFFILTVVCAITLVVCLAILTAIRLCVQCASGVNTLLFVPAFYIYN TGRNAYFKFQENRPPFPPEDWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FYB Antibody (Biotin)
KB-2071-01 50 μL

FYB Antibody (Biotin)

Sign In for Pricing
View Details
FYB Antibody (Biotin)
KB-2071-02 100 µL

FYB Antibody (Biotin)

Sign In for Pricing
View Details
FYB Antibody (Biotin)
KB-2071-03 1 mL

FYB Antibody (Biotin)

Sign In for Pricing
View Details
Frozen Tissue Sections, Cervix
CS642051 5x 5 µm

Frozen Tissue Sections, Cervix

Sign In for Pricing
View Details
Mouse Axin1 activation kit by CRISPRa
GA200356 1 Kit

Mouse Axin1 activation kit by CRISPRa

Sign In for Pricing
View Details
GF-1 Plant Starter Kit / Taq DNA Polymerase, 25 preps
GF-PT-K 25 Preparations

GF-1 Plant Starter Kit / Taq DNA Polymerase, 25 preps

Sign In for Pricing
View Details