Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU4 Envelope small membrane protein (E)

This Recombinant Bat coronavirus HKU4 Envelope small membrane protein (E) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

A3EX99

Expression Region

1-82

Origin

Bat coronavirus HKU4 (BtCoV) (BtCoV/HKU4/2004)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFVHEQIGTIIVNFFILTVVCAITLVVCLAILTAIRLCVQCASGVNTLLFVPAFYIYN TGRNAYFKFQENRPPFPPEDWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D1]
TA810268AM 100 µL

MLH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D1]

Sign In for Pricing
View Details
MGAT1 (NM_001114619) Human Over-expression Lysate
LY426496 100 µg

MGAT1 (NM_001114619) Human Over-expression Lysate

Sign In for Pricing
View Details
NPBWR2 (NM_005286) Human Over-expression Lysate
LY401628 100 µg

NPBWR2 (NM_005286) Human Over-expression Lysate

Sign In for Pricing
View Details
EGFR (31G7), CF647 conjugate, 0.1mg/mL
BNC471194-500 1x 500 µL

EGFR (31G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dodecylbenzenesulfonic Acid (70 wt. % in isopropanol, Technical grade, Mixture of different chain lengths)
TRC-D525663-1G 1 g

Dodecylbenzenesulfonic Acid (70 wt. % in isopropanol, Technical grade, Mixture of different chain lengths)

Sign In for Pricing
View Details
2-Butyne-1,4-diol-(1,1,4,4)-d4, Diacetate
TRC-B755027-10MG 10 mg

2-Butyne-1,4-diol-(1,1,4,4)-d4, Diacetate

Sign In for Pricing
View Details