Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A5GIB0

Expression Region

1-82

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTGERPFFEIITSIRYWVIHAITLPSIFLAGFLFVSTGLAYDAFGTPRPDAYFQAT ESKAPVVSQRYEGKSQLDDRLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbocisteine Sulfoxide (Mixture of diastereomers)
TRC-C178780-250MG 250 mg

Carbocisteine Sulfoxide (Mixture of diastereomers)

Sign In for Pricing
View Details
4-Ethylphenol-2,3,5,6-d4,OD
TRC-E925736-10MG 10 mg

4-Ethylphenol-2,3,5,6-d4,OD

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), 0.2mg/mL
BNUB1832-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), 0.2mg/mL

Sign In for Pricing
View Details
PITPNB (NM_012399) Human Recombinant Protein
TP304262M 100 µg

PITPNB (NM_012399) Human Recombinant Protein

Sign In for Pricing
View Details
Importin 7 (IPO7) Human Gene Knockout Kit (CRISPR)
KN415943 1 Kit

Importin 7 (IPO7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD5 Human Gene Knockout Kit (CRISPR)
KN206494BN 1 Kit

CD5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details