Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit c (atpE)

This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5GV76

Expression Region

1-82

Origin

Synechococcus sp. (strain RCC307)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLAAIGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFM ESLTIYGLVVALVLLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTN3A1 CRISPRa sgRNA lentivector (set of three targets)(Human)
13564121 3x 1.0µg DNA

BTN3A1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Plasma Anticoagulant Protein C (PC) Antibody (Biotin)
abx314900-01 20 µg

Plasma Anticoagulant Protein C (PC) Antibody (Biotin)

Sign In for Pricing
View Details
Plasma Anticoagulant Protein C (PC) Antibody (Biotin)
abx314900-02 50 µg

Plasma Anticoagulant Protein C (PC) Antibody (Biotin)

Sign In for Pricing
View Details
Plasma Anticoagulant Protein C (PC) Antibody (Biotin)
abx314900-03 100 µg

Plasma Anticoagulant Protein C (PC) Antibody (Biotin)

Sign In for Pricing
View Details
Plasma Anticoagulant Protein C (PC) Antibody (Biotin)
abx314900-04 200 µg

Plasma Anticoagulant Protein C (PC) Antibody (Biotin)

Sign In for Pricing
View Details
Plasma Anticoagulant Protein C (PC) Antibody (Biotin)
abx314900-05 1 mg

Plasma Anticoagulant Protein C (PC) Antibody (Biotin)

Sign In for Pricing
View Details