Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit c (atpE)

This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5GV76

Expression Region

1-82

Origin

Synechococcus sp. (strain RCC307)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLAAIGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFM ESLTIYGLVVALVLLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VDAC3P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2608806 1.0 µg DNA

VDAC3P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
IL3RB Antibody
62-263 400 µL

IL3RB Antibody

Sign In for Pricing
View Details
ZNF680
582407-01 50 µg

ZNF680

Sign In for Pricing
View Details
ZNF680
582407-02 100 µg

ZNF680

Sign In for Pricing
View Details
(Rac) -Desethyl Oxybutynin-d11 (hydrochloride)
HY-132650S-01 1 mg

(Rac) -Desethyl Oxybutynin-d11 (hydrochloride)

Sign In for Pricing
View Details
(Rac) -Desethyl Oxybutynin-d11 (hydrochloride)
HY-132650S-02 10 mg

(Rac) -Desethyl Oxybutynin-d11 (hydrochloride)

Sign In for Pricing
View Details