Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit c (atpE)

This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5GND2

Expression Region

1-82

Origin

Synechococcus sp. (strain WH7803)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDLTSAASVLAAALAVGLAAIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc64b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6180008 1.0 µg DNA

Ccdc64b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM143 Antibody
NBP2-83672-0.1mL 0.1 mL

Rabbit Polyclonal TMEM143 Antibody

Sign In for Pricing
View Details
ZDHHC20 Antibody, FITC conjugated
A57614-50UG 50 µg

ZDHHC20 Antibody, FITC conjugated

Sign In for Pricing
View Details
CD150/SLAM Rabbit pAb
A2044-01 20 µL

CD150/SLAM Rabbit pAb

Sign In for Pricing
View Details
CD150/SLAM Rabbit pAb
A2044-02 1000 μL

CD150/SLAM Rabbit pAb

Sign In for Pricing
View Details
CD150/SLAM Rabbit pAb
A2044-03 100 μL

CD150/SLAM Rabbit pAb

Sign In for Pricing
View Details